In this exercise we’ll look at a sequence with known tandem repeats. We’ll load the data, explore it in R, then use the dotPlot() function to make various dotplots to see how changing settings for dotPlots() help make repeat patterns stand out.

Add the necessary code to make this script functional.

Preliminaries

Load packages

library(seqinr)
library(rentrez)
library(compbio4all)
library(Biostrings)
## Loading required package: BiocGenerics
## Loading required package: parallel
## 
## Attaching package: 'BiocGenerics'
## The following objects are masked from 'package:parallel':
## 
##     clusterApply, clusterApplyLB, clusterCall, clusterEvalQ,
##     clusterExport, clusterMap, parApply, parCapply, parLapply,
##     parLapplyLB, parRapply, parSapply, parSapplyLB
## The following objects are masked from 'package:stats':
## 
##     IQR, mad, sd, var, xtabs
## The following objects are masked from 'package:base':
## 
##     anyDuplicated, append, as.data.frame, basename, cbind, colnames,
##     dirname, do.call, duplicated, eval, evalq, Filter, Find, get, grep,
##     grepl, intersect, is.unsorted, lapply, Map, mapply, match, mget,
##     order, paste, pmax, pmax.int, pmin, pmin.int, Position, rank,
##     rbind, Reduce, rownames, sapply, setdiff, sort, table, tapply,
##     union, unique, unsplit, which.max, which.min
## Loading required package: S4Vectors
## Loading required package: stats4
## 
## Attaching package: 'S4Vectors'
## The following objects are masked from 'package:base':
## 
##     expand.grid, I, unname
## Loading required package: IRanges
## 
## Attaching package: 'IRanges'
## The following object is masked from 'package:grDevices':
## 
##     windows
## Loading required package: XVector
## Loading required package: GenomeInfoDb
## 
## Attaching package: 'Biostrings'
## The following object is masked from 'package:seqinr':
## 
##     translate
## The following object is masked from 'package:base':
## 
##     strsplit

Get data

Download sequence P73709

P73709_FASTA <- rentrez::entrez_fetch(id = "P73709",
                                      db = "protein", 
                                      rettype="fasta")

Clean and set up sequence as vector.

NOTE: no arguments besides sequence passed to fasta_cleaner() - we do this differently for pairwise alignment

P73709_vector <- fasta_cleaner(P73709_FASTA)

Set up as 1 continuous string

P73709_string <- fasta_cleaner(P73709_FASTA, 
                               parse = F)

Compare structure of each type

str(P73709_FASTA)
##  chr ">sp|P73709.1|Y1819_SYNY3 RecName: Full=Uncharacterized protein slr1819\nMEAKELVQRYRNGETLFTGLKLPGINLEAADLIGIVLNE"| __truncated__
str(P73709_vector)
##  chr [1:331] "M" "E" "A" "K" "E" "L" "V" "Q" "R" "Y" "R" "N" "G" "E" "T" ...
str(P73709_string)
##  chr "MEAKELVQRYRNGETLFTGLKLPGINLEAADLIGIVLNEADLRGANLLFCYLNRANLGQANLVAANLSGASLNQADLAGADLRSANFHGAMLQGAILRDSDMTLATLQDTN"| __truncated__

For fun - make a global pairwiser alignment

Takes data in STRING form!

align <- pairwiseAlignment(P73709_vector, 
                           P73709_vector, 
                           type = "global")

Look at PID

pid(align)
##   [1] 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100
##  [19] 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100
##  [37] 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100
##  [55] 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100
##  [73] 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100
##  [91] 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100
## [109] 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100
## [127] 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100
## [145] 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100
## [163] 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100
## [181] 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100
## [199] 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100
## [217] 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100
## [235] 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100
## [253] 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100
## [271] 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100
## [289] 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100
## [307] 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100
## [325] 100 100 100 100 100 100 100

Explore vector data

Raw fasta

str()

str(P73709_vector)
##  chr [1:331] "M" "E" "A" "K" "E" "L" "V" "Q" "R" "Y" "R" "N" "G" "E" "T" ...

Vectors

[ ]

P73709_vector[]
##   [1] "M" "E" "A" "K" "E" "L" "V" "Q" "R" "Y" "R" "N" "G" "E" "T" "L" "F" "T"
##  [19] "G" "L" "K" "L" "P" "G" "I" "N" "L" "E" "A" "A" "D" "L" "I" "G" "I" "V"
##  [37] "L" "N" "E" "A" "D" "L" "R" "G" "A" "N" "L" "L" "F" "C" "Y" "L" "N" "R"
##  [55] "A" "N" "L" "G" "Q" "A" "N" "L" "V" "A" "A" "N" "L" "S" "G" "A" "S" "L"
##  [73] "N" "Q" "A" "D" "L" "A" "G" "A" "D" "L" "R" "S" "A" "N" "F" "H" "G" "A"
##  [91] "M" "L" "Q" "G" "A" "I" "L" "R" "D" "S" "D" "M" "T" "L" "A" "T" "L" "Q"
## [109] "D" "T" "N" "L" "I" "G" "A" "D" "L" "R" "G" "A" "D" "L" "S" "G" "A" "T"
## [127] "L" "T" "G" "A" "C" "L" "R" "G" "A" "N" "M" "R" "Q" "E" "K" "K" "G" "Y"
## [145] "Y" "T" "N" "L" "Q" "A" "A" "I" "L" "G" "R" "A" "D" "L" "Q" "G" "A" "N"
## [163] "M" "K" "G" "V" "D" "L" "S" "R" "A" "D" "L" "S" "Y" "A" "N" "L" "K" "E"
## [181] "A" "N" "L" "R" "D" "V" "D" "L" "R" "K" "A" "D" "L" "S" "Y" "A" "N" "L"
## [199] "K" "G" "A" "L" "L" "T" "D" "A" "N" "L" "S" "G" "A" "K" "L" "N" "G" "A"
## [217] "D" "L" "Q" "N" "A" "N" "L" "M" "R" "A" "K" "I" "S" "E" "A" "E" "M" "T"
## [235] "A" "V" "N" "C" "Q" "G" "A" "I" "M" "T" "H" "V" "N" "L" "N" "R" "T" "N"
## [253] "L" "T" "G" "S" "N" "L" "S" "F" "T" "R" "M" "N" "S" "A" "D" "L" "S" "R"
## [271] "A" "N" "L" "T" "K" "A" "N" "L" "Q" "E" "A" "E" "L" "I" "E" "A" "F" "F"
## [289] "A" "R" "A" "N" "L" "T" "E" "A" "N" "F" "I" "N" "A" "N" "L" "V" "R" "A"
## [307] "D" "L" "M" "S" "A" "N" "M" "V" "G" "A" "D" "F" "Q" "G" "A" "T" "M" "P"
## [325] "D" "G" "Q" "V" "R" "H" "H"

[x:y]

P73709_vector[1:50]
##  [1] "M" "E" "A" "K" "E" "L" "V" "Q" "R" "Y" "R" "N" "G" "E" "T" "L" "F" "T" "G"
## [20] "L" "K" "L" "P" "G" "I" "N" "L" "E" "A" "A" "D" "L" "I" "G" "I" "V" "L" "N"
## [39] "E" "A" "D" "L" "R" "G" "A" "N" "L" "L" "F" "C"

length()

length(P73709_vector)
## [1] 331

table()

table(P73709_vector)
## P73709_vector
##  A  C  D  E  F  G  H  I  K  L  M  N  P  Q  R  S  T  V  Y 
## 53  3 21 13  8 27  4 10 11 52 12 34  2 13 20 15 17 10  6

Default dotplot from R

Note orientation. Any strong diagonals?

dotPlot(P73709_vector, 
        P73709_vector)

Arguements of dotPlot

Default is exact match (binary):

dotPlot(P73709_vector, 
        P73709_vector, 
        wsize = 1, 
        wstep = 1,
        nmatch = 1)

Don’t vary wstep

dotPlot(P73709_vector, 
        P73709_vector, 
        wsize = 20, 
        nmatch = 5)

main = … sets a title

I’ll use "Default: wsize = 1, nmatch = 1

dotPlot(P73709_vector, 
        P73709_vector, 
        wsize = 1, 
        nmatch = 1, 
        main = "Default values")

We can make a grid of plots with the par() command (we’ll leave this as a black box for now) mfrow sets layout of grid mar sets margins

# set up 2 x 2 grid, make margins things
par(mfrow = c(2,2), 
    mar = c(0,0,2,1))

# plot 1: Defaults
dotPlot(P73709_vector, P73709_vector, 
        wsize = 1, 
        nmatch = 1, 
        main = "Defaults")

# plot 2 size = 10, nmatch = 1
dotPlot(P73709_vector, P73709_vector, 
        wsize = 10, 
        nmatch = 1, 
        main = "Window Size 10 #1")

# plot 3: size = 10, nmatch = 5
dotPlot(P73709_vector, P73709_vector, 
        wsize = 10, 
        nmatch = 5, 
        main = "Window Size 10 #2")

# plot 4: size = 20, nmatch = 5
dotPlot(P73709_vector, P73709_vector, 
        wsize = 20,
        nmatch = 5,
        main = "Window size 20")

# reset par() - run this or other plots will be small!
par(mfrow = c(1,1), 
    mar = c(4,4,4,4))

Dialed in

wsize = 20, wstep = 1, nmatch = 5

# be sure to run par - re-run just in case
par(mfrow = c(1,1), 
    mar = c(4,4,4,4))


dotPlot(P73709_vector, 
        P73709_vector,
        wsize = 20,
        nmatch = 5)

Diagonal dropped

Make new function

dot_plot <- function(seq1, seq2, wsize = 1, wstep = 1, nmatch = 1, col = c("white", 
    "black"), xlab = deparse(substitute(seq1)), ylab = deparse(substitute(seq2)), 
    ...) {
  
  # make sure input works
    if (nchar(seq1[1]) > 1) 
        stop("seq1 should be provided as a vector of single chars")
    if (nchar(seq2[1]) > 1) 
        stop("seq2 should be provided as a vector of single chars")
    if (wsize < 1) 
        stop("non allowed value for wsize")
    if (wstep < 1) 
        stop("non allowed value for wstep")
    if (nmatch < 1) 
        stop("non allowed value for nmatch")
    if (nmatch > wsize) 
        stop("nmatch > wsize is not allowed")
  
  # internal function
    mkwin <- function(seq, wsize, wstep) {
        sapply(seq(from = 1, to = length(seq) - wsize + 1, by = wstep), 
            function(i) c2s(seq[i:(i + wsize - 1)]))
    }
    wseq1 <- mkwin(seq1, wsize, wstep)
    wseq2 <- mkwin(seq2, wsize, wstep)
    if (nmatch == wsize) {
        xy <- outer(wseq1, wseq2, "==")
    }
    else {
        "%==%" <- function(x, y) colSums(sapply(x, s2c) == sapply(y, 
            s2c)) >= nmatch
        xy <- outer(wseq1, wseq2, "%==%")
    }
    
    # compile output in list
    out <- list(x = seq(from = 1, to = length(seq1), length = length(wseq1)),
                y = seq(from = 1, to = length(seq2), length = length(wseq2)),
                z = xy)
}

Use new function, save output (doesn’t autoplot)

my_dot_out <- dot_plot(P73709_vector,
                       P73709_vector, 
        wsize = 15, 
        wstep = 1,
        nmatch = 5)

Get rid of upper triangular portion

my_dot_out$z[lower.tri(my_dot_out$z)] <- FALSE

Do some weird prep (don’t worry about it)

my_dot_out$z <- my_dot_out$z[, nrow(my_dot_out$z):1]

Plot using image() command

# seriously - it will drive you crazy if you forget about this
par(mfrow = c(1,1), 
    mar = c(4,4,4,4))

# plot with image()
image(x = my_dot_out$x, 
      y = my_dot_out$y, 
      z = my_dot_out$z)

Other examples

P24587

P24587 <- rentrez::entrez_fetch(id = "P24587",
                                db = "protein", 
                                rettype="fasta")

P24587 <- fasta_cleaner(P24587)

length(P24587)
## [1] 714
# Use [ : ] to subset 300 to 400 
dotPlot(P24587[300:400],
        P24587[300:400],
        wsize = 15, 
        wstep = 1,
        nmatch = 5)

P02840

P02840 <- rentrez::entrez_fetch(id = "P02840",db = "protein", rettype="fasta")

P02840 <- fasta_cleaner(P02840)
length(P02840)
## [1] 307
# set limit to 80 to 113
dotPlot(P02840[80:113],P02840[80:113],
        wsize = 5, 
        wstep = 1,
        nmatch = 5)

P19246

P19246 <- rentrez::entrez_fetch(id = "P19246",
                                db = "protein", 
                                rettype="fasta")

P19246 <- fasta_cleaner(P19246)
length(P19246)
## [1] 1090
# full
dotPlot(P19246,P19246,
        wsize = 1, 
        wstep = 1,
        nmatch = 1)

# set limit to 525:550
dotPlot(P19246[525:550],P19246[525:550],
        wsize = 1, 
        wstep = 1,
        nmatch = 1)

Q55837

Q55837 <- rentrez::entrez_fetch(id = "Q55837",
                                db = "protein", 
                                rettype="fasta")

Q55837 <- fasta_cleaner(Q55837)
dotPlot(Q55837,
        Q55837)