Assignment: Your assignment is to use your notes from class - along with help from classmates, UTAs, and me - to turn this script into a fleshed-out description of what is going on.

This is a substantial project - we’ll work on it in steps over the rest of the unit.

We are currently focused on the overall process and will cover the details over the rest of this unit.

Your first assignment is to get this script to run from top to bottom by adding all of the missing R commands. Once you have done that, you can knit it into an HTML file and upload it to RPubs. (Note - you’ll need to add the YAML header!)

Your second assignment, which will be posted later, is to answer all the TODO and other prompts to add information. You can start on this, but you don’t have to do this on your first time through the code.

Delete all the prompts like TODO() as you compete them. Use RStudio’s search function to see if you’ve missed any - there are a LOT!

A complete bioinformatics workflow in R

By: Nathan L. Brouwer

“Worked example: Building a phylogeny in R”

Introduction

Describe how phylogeneies can be used in biology (readings will be assigned)

Phylogenies can be used in biology to represent hypotheses about the evolutionary relationships of certain genes, species, or taxa.

Vocab

Make a list of at least 10 vocab terms that are important (don’t have to define)

  1. MSA
  2. BLAST
  3. global alignment
  4. local alignment
  5. consensus sequence
  6. substitution matrix
  7. sequence motif
  8. protein domain
  9. Homology
  10. Clade

Key functions

Make a list of at least 5 key functions Put in the format of package::function

  1. rentrez::entrez_fetch()
  2. stringr::str_split
  3. Biostrings::pairwiseAlignment
  4. Biostrings::pid
  5. Biostrings:: AAStringSet

Software Preliminaires

Add the necessary calls to library() to load call packages Indicate which packages cam from Bioconductor, CRAN, and GitHub

Load packages into memory

# github packages
library(compbio4all)
library(ggmsa)

# CRAN packages



# Bioconductor packages
library(Biostrings)
library(msa)

Downloading macromolecular sequences

TODO: Fill in the XXXXXs and write a 1-2 sentence of what is going on here.
Add the package that is where entrez_fetch is from using :: notation

Here, we are downloading the raw sequence for hShroom3.

# Human shroom 3 (H. sapiens)
hShroom3 <- rentrez::entrez_fetch(db = "protein", 
                          id = "NP_065910", 
                          rettype = "fasta")

TODO:explain what cat() is doing

This function respects the /n character and starts a new line where the character is written.

cat(hShroom3)
## >NP_065910.3 protein Shroom3 [Homo sapiens]
## MMRTTEDFHKPSATLNSNTATKGRYIYLEAFLEGGAPWGFTLKGGLEHGEPLIISKVEEGGKADTLSSKL
## QAGDEVVHINEVTLSSSRKEAVSLVKGSYKTLRLVVRRDVCTDPGHADTGASNFVSPEHLTSGPQHRKAA
## WSGGVKLRLKHRRSEPAGRPHSWHTTKSGEKQPDASMMQISQGMIGPPWHQSYHSSSSTSDLSNYDHAYL
## RRSPDQCSSQGSMESLEPSGAYPPCHLSPAKSTGSIDQLSHFHNKRDSAYSSFSTSSSILEYPHPGISGR
## ERSGSMDNTSARGGLLEGMRQADIRYVKTVYDTRRGVSAEYEVNSSALLLQGREARASANGQGYDKWSNI
## PRGKGVPPPSWSQQCPSSLETATDNLPPKVGAPLPPARSDSYAAFRHRERPSSWSSLDQKRLCRPQANSL
## GSLKSPFIEEQLHTVLEKSPENSPPVKPKHNYTQKAQPGQPLLPTSIYPVPSLEPHFAQVPQPSVSSNGM
## LYPALAKESGYIAPQGACNKMATIDENGNQNGSGRPGFAFCQPLEHDLLSPVEKKPEATAKYVPSKVHFC
## SVPENEEDASLKRHLTPPQGNSPHSNERKSTHSNKPSSHPHSLKCPQAQAWQAGEDKRSSRLSEPWEGDF
## QEDHNANLWRRLEREGLGQSLSGNFGKTKSAFSSLQNIPESLRRHSSLELGRGTQEGYPGGRPTCAVNTK
## AEDPGRKAAPDLGSHLDRQVSYPRPEGRTGASASFNSTDPSPEEPPAPSHPHTSSLGRRGPGPGSASALQ
## GFQYGKPHCSVLEKVSKFEQREQGSQRPSVGGSGFGHNYRPHRTVSTSSTSGNDFEETKAHIRFSESAEP
## LGNGEQHFKNGELKLEEASRQPCGQQLSGGASDSGRGPQRPDARLLRSQSTFQLSSEPEREPEWRDRPGS
## PESPLLDAPFSRAYRNSIKDAQSRVLGATSFRRRDLELGAPVASRSWRPRPSSAHVGLRSPEASASASPH
## TPRERHSVTPAEGDLARPVPPAARRGARRRLTPEQKKRSYSEPEKMNEVGIVEEAEPAPLGPQRNGMRFP
## ESSVADRRRLFERDGKACSTLSLSGPELKQFQQSALADYIQRKTGKRPTSAAGCSLQEPGPLRERAQSAY
## LQPGPAALEGSGLASASSLSSLREPSLQPRREATLLPATVAETQQAPRDRSSSFAGGRRLGERRRGDLLS
## GANGGTRGTQRGDETPREPSSWGARAGKSMSAEDLLERSDVLAGPVHVRSRSSPATADKRQDVLLGQDSG
## FGLVKDPCYLAGPGSRSLSCSERGQEEMLPLFHHLTPRWGGSGCKAIGDSSVPSECPGTLDHQRQASRTP
## CPRPPLAGTQGLVTDTRAAPLTPIGTPLPSAIPSGYCSQDGQTGRQPLPPYTPAMMHRSNGHTLTQPPGP
## RGCEGDGPEHGVEEGTRKRVSLPQWPPPSRAKWAHAAREDSLPEESSAPDFANLKHYQKQQSLPSLCSTS
## DPDTPLGAPSTPGRISLRISESVLRDSPPPHEDYEDEVFVRDPHPKATSSPTFEPLPPPPPPPPSQETPV
## YSMDDFPPPPPHTVCEAQLDSEDPEGPRPSFNKLSKVTIARERHMPGAAHVVGSQTLASRLQTSIKGSEA
## ESTPPSFMSVHAQLAGSLGGQPAPIQTQSLSHDPVSGTQGLEKKVSPDPQKSSEDIRTEALAKEIVHQDK
## SLADILDPDSRLKTTMDLMEGLFPRDVNLLKENSVKRKAIQRTVSSSGCEGKRNEDKEAVSMLVNCPAYY
## SVSAPKAELLNKIKEMPAEVNEEEEQADVNEKKAELIGSLTHKLETLQEAKGSLLTDIKLNNALGEEVEA
## LISELCKPNEFDKYRMFIGDLDKVVNLLLSLSGRLARVENVLSGLGEDASNEERSSLYEKRKILAGQHED
## ARELKENLDRRERVVLGILANYLSEEQLQDYQHFVKMKSTLLIEQRKLDDKIKLGQEQVKCLLESLPSDF
## IPKAGALALPPNLTSEPIPAGGCTFSGIFPTLTSPL

TODO: explain what this code chunk is doing

This code chunk is downloading the mShroom3a sequence, the hShroom2 sequence, and the sShroom sequence.

# Mouse shroom 3a (M. musculus)
mShroom3a <- rentrez::entrez_fetch(db = "protein", 
                          id = "AAF13269", 
                          rettype = "fasta")

# Human shroom 2 (H. sapiens)
hShroom2 <- rentrez::entrez_fetch(db = "protein", 
                          id = "CAA58534", 
                          rettype = "fasta")


# Sea-urchin shroom
sShroom <- rentrez::entrez_fetch(db = "protein", 
                          id = "XP_783573", 
                          rettype = "fasta")

TODO: Explain what this code chunk is doing

This code chunk returns the number of characters in each of the four shrooms that we’ve downloaded.

nchar(hShroom3)
## [1] 2070
nchar(mShroom3a)
## [1] 2083
nchar(sShroom)
## [1] 1758
nchar(hShroom2)
## [1] 1673

Prepping macromolecular sequences

TODO: Explain what this function does

This function cleans our raw sequence data so that they are in the appropriate form for alignments and creating phylogenetic trees.

library(compbio4all)
fasta_cleaner
## function (fasta_object, parse = TRUE) 
## {
##     fasta_object <- sub("^(>)(.*?)(\\n)(.*)(\\n\\n)", "\\4", 
##         fasta_object)
##     fasta_object <- gsub("\n", "", fasta_object)
##     if (parse == TRUE) {
##         fasta_object <- stringr::str_split(fasta_object, pattern = "", 
##             simplify = FALSE)
##     }
##     return(fasta_object[[1]])
## }
## <bytecode: 0x00000000283e21a8>
## <environment: namespace:compbio4all>

TODO: explain how to add the function to your R session even if you can’t download compbio4all

If you can’t download compbio4all, you can add the literal code to run the function in your script.

fasta_cleaner <- function(fasta_object, parse = TRUE){

  fasta_object <- sub("^(>)(.*?)(\\n)(.*)(\\n\\n)","\\4",fasta_object)
  fasta_object <- gsub("\n", "", fasta_object)

  if(parse == TRUE){
    fasta_object <- stringr::str_split(fasta_object,
                                       pattern = "",
                                       simplify = FALSE)
  }

  return(fasta_object[[1]])
}

TODO: briefly explain what this code chunk is doing

This code chunk runs the fasta_cleaner function on each of our 4 raw sequences so that they will be cleaned.

hShroom3  <- fasta_cleaner(hShroom3,  parse = F)
mShroom3a <- fasta_cleaner(mShroom3a, parse = F)
hShroom2  <- fasta_cleaner(hShroom2,  parse = F)
sShroom   <- fasta_cleaner(sShroom,   parse = F)
hShroom3
## [1] "MMRTTEDFHKPSATLNSNTATKGRYIYLEAFLEGGAPWGFTLKGGLEHGEPLIISKVEEGGKADTLSSKLQAGDEVVHINEVTLSSSRKEAVSLVKGSYKTLRLVVRRDVCTDPGHADTGASNFVSPEHLTSGPQHRKAAWSGGVKLRLKHRRSEPAGRPHSWHTTKSGEKQPDASMMQISQGMIGPPWHQSYHSSSSTSDLSNYDHAYLRRSPDQCSSQGSMESLEPSGAYPPCHLSPAKSTGSIDQLSHFHNKRDSAYSSFSTSSSILEYPHPGISGRERSGSMDNTSARGGLLEGMRQADIRYVKTVYDTRRGVSAEYEVNSSALLLQGREARASANGQGYDKWSNIPRGKGVPPPSWSQQCPSSLETATDNLPPKVGAPLPPARSDSYAAFRHRERPSSWSSLDQKRLCRPQANSLGSLKSPFIEEQLHTVLEKSPENSPPVKPKHNYTQKAQPGQPLLPTSIYPVPSLEPHFAQVPQPSVSSNGMLYPALAKESGYIAPQGACNKMATIDENGNQNGSGRPGFAFCQPLEHDLLSPVEKKPEATAKYVPSKVHFCSVPENEEDASLKRHLTPPQGNSPHSNERKSTHSNKPSSHPHSLKCPQAQAWQAGEDKRSSRLSEPWEGDFQEDHNANLWRRLEREGLGQSLSGNFGKTKSAFSSLQNIPESLRRHSSLELGRGTQEGYPGGRPTCAVNTKAEDPGRKAAPDLGSHLDRQVSYPRPEGRTGASASFNSTDPSPEEPPAPSHPHTSSLGRRGPGPGSASALQGFQYGKPHCSVLEKVSKFEQREQGSQRPSVGGSGFGHNYRPHRTVSTSSTSGNDFEETKAHIRFSESAEPLGNGEQHFKNGELKLEEASRQPCGQQLSGGASDSGRGPQRPDARLLRSQSTFQLSSEPEREPEWRDRPGSPESPLLDAPFSRAYRNSIKDAQSRVLGATSFRRRDLELGAPVASRSWRPRPSSAHVGLRSPEASASASPHTPRERHSVTPAEGDLARPVPPAARRGARRRLTPEQKKRSYSEPEKMNEVGIVEEAEPAPLGPQRNGMRFPESSVADRRRLFERDGKACSTLSLSGPELKQFQQSALADYIQRKTGKRPTSAAGCSLQEPGPLRERAQSAYLQPGPAALEGSGLASASSLSSLREPSLQPRREATLLPATVAETQQAPRDRSSSFAGGRRLGERRRGDLLSGANGGTRGTQRGDETPREPSSWGARAGKSMSAEDLLERSDVLAGPVHVRSRSSPATADKRQDVLLGQDSGFGLVKDPCYLAGPGSRSLSCSERGQEEMLPLFHHLTPRWGGSGCKAIGDSSVPSECPGTLDHQRQASRTPCPRPPLAGTQGLVTDTRAAPLTPIGTPLPSAIPSGYCSQDGQTGRQPLPPYTPAMMHRSNGHTLTQPPGPRGCEGDGPEHGVEEGTRKRVSLPQWPPPSRAKWAHAAREDSLPEESSAPDFANLKHYQKQQSLPSLCSTSDPDTPLGAPSTPGRISLRISESVLRDSPPPHEDYEDEVFVRDPHPKATSSPTFEPLPPPPPPPPSQETPVYSMDDFPPPPPHTVCEAQLDSEDPEGPRPSFNKLSKVTIARERHMPGAAHVVGSQTLASRLQTSIKGSEAESTPPSFMSVHAQLAGSLGGQPAPIQTQSLSHDPVSGTQGLEKKVSPDPQKSSEDIRTEALAKEIVHQDKSLADILDPDSRLKTTMDLMEGLFPRDVNLLKENSVKRKAIQRTVSSSGCEGKRNEDKEAVSMLVNCPAYYSVSAPKAELLNKIKEMPAEVNEEEEQADVNEKKAELIGSLTHKLETLQEAKGSLLTDIKLNNALGEEVEALISELCKPNEFDKYRMFIGDLDKVVNLLLSLSGRLARVENVLSGLGEDASNEERSSLYEKRKILAGQHEDARELKENLDRRERVVLGILANYLSEEQLQDYQHFVKMKSTLLIEQRKLDDKIKLGQEQVKCLLESLPSDFIPKAGALALPPNLTSEPIPAGGCTFSGIFPTLTSPL"

Doing pairwise alignment of sequences

TODO: give this a title. Explain what code below is doing

This code follows certain rules to figure out the best alignment of two sequences, and then gives that alignment a score.

library(Biostrings)
# add necessary function
align.h3.vs.m3a <- Biostrings::pairwiseAlignment          (
                  hShroom3,
                  mShroom3a)

TODO: In 1-2 sentence explain what this object shows

This code performs pairwise alignment of h3 and m3a shrooms.

align.h3.vs.m3a
## Global PairwiseAlignmentsSingleSubject (1 of 1)
## pattern: MMRTTEDFHKPSATLN-SNTATKGRYIYLEAFLE...KAGALALPPNLTSEPIPAGGCTFSGIFPTLTSPL
## subject: MK-TPENLEEPSATPNPSRTPTE-RFVYLEALLE...KAGAISLPPALTGHATPGGTSVFGGVFPTLTSPL
## score: 2189.934

TODO: explain what this is showing

This code calculates the percentage identity of these two sequences. It counts every matching position and divides it by the total number of positions.

# add necessary function
Biostrings::pid(align.h3.vs.m3a)
## [1] 70.56511

TODO: briefly explain what is going on here versus the previous code chunk

This code does not print anything out, but it calculates a score for the alignment of hShroom3 and hShroom2.

align.h3.vs.h2 <- Biostrings::pairwiseAlignment(
                  hShroom3,
                  hShroom2)

TODO: explain what is going on here and compare and contrast with previous ouput

This code prints out the score of the alignment of h3 and h2.

score(align.h3.vs.h2)
## [1] -5673.853

TODO: briefly explian the difference between the output of score() and pid() (can be very brief - we’ll get into the details later)

Unlike pid, scoring takes indels into consideration and assigns indels a value of -1.

Biostrings::pid(align.h3.vs.h2)
## [1] 33.83277

The shroom family of genes

TODO: briefly explain why I have this whole table here

This table takes a series of shrooms and consolidates them in this object.

shroom_table <- c("CAA78718" , "X. laevis Apx" ,         "xShroom1",
            "NP_597713" , "H. sapiens APXL2" ,     "hShroom1",
            "CAA58534" , "H. sapiens APXL",        "hShroom2",
            "ABD19518" , "M. musculus Apxl" ,      "mShroom2",
            "AAF13269" , "M. musculus ShroomL" ,   "mShroom3a",
            "AAF13270" , "M. musculus ShroomS" ,   "mShroom3b",
            "NP_065910", "H. sapiens Shroom" ,     "hShroom3",
            "ABD59319" , "X. laevis Shroom-like",  "xShroom3",
            "NP_065768", "H. sapiens KIAA1202" ,   "hShroom4a",
            "AAK95579" , "H. sapiens SHAP-A" ,     "hShroom4b",
            #"DQ435686" , "M. musculus KIAA1202" ,  "mShroom4",
            "ABA81834" , "D. melanogaster Shroom", "dmShroom",
            "EAA12598" , "A. gambiae Shroom",      "agShroom",
            "XP_392427" , "A. mellifera Shroom" ,  "amShroom",
            "XP_783573" , "S. purpuratus Shroom" , "spShroom") #sea urchin

TODO: write a short sentence explaining what this next code chunk will do, then annotate each line with what was done.

This next code chunk takes the shroom_table object and organizes it in a more visibly and logically clear format.

# convert to matrix
shroom_table_matrix <- matrix(shroom_table,
                                  byrow = T,
                                  nrow = 14)
# convert to data_frame
shroom_table <- data.frame(shroom_table_matrix, 
                     stringsAsFactors = F)

# naming columns
names(shroom_table) <- c("accession", "name.orig","name.new")

# Create simplified species names
shroom_table$spp <- "Homo"
shroom_table$spp[grep("laevis",shroom_table$name.orig)] <- "Xenopus"
shroom_table$spp[grep("musculus",shroom_table$name.orig)] <- "Mus"
shroom_table$spp[grep("melanogaster",shroom_table$name.orig)] <- "Drosophila"
shroom_table$spp[grep("gambiae",shroom_table$name.orig)] <- "mosquito"
shroom_table$spp[grep("mellifera",shroom_table$name.orig)] <- "bee"
shroom_table$spp[grep("purpuratus",shroom_table$name.orig)] <- "sea urchin"

TODO: in a brief sentence explain what this is doing

This code prints out the modified shroom_table object.

shroom_table
##    accession              name.orig  name.new        spp
## 1   CAA78718          X. laevis Apx  xShroom1    Xenopus
## 2  NP_597713       H. sapiens APXL2  hShroom1       Homo
## 3   CAA58534        H. sapiens APXL  hShroom2       Homo
## 4   ABD19518       M. musculus Apxl  mShroom2        Mus
## 5   AAF13269    M. musculus ShroomL mShroom3a        Mus
## 6   AAF13270    M. musculus ShroomS mShroom3b        Mus
## 7  NP_065910      H. sapiens Shroom  hShroom3       Homo
## 8   ABD59319  X. laevis Shroom-like  xShroom3    Xenopus
## 9  NP_065768    H. sapiens KIAA1202 hShroom4a       Homo
## 10  AAK95579      H. sapiens SHAP-A hShroom4b       Homo
## 11  ABA81834 D. melanogaster Shroom  dmShroom Drosophila
## 12  EAA12598      A. gambiae Shroom  agShroom   mosquito
## 13 XP_392427    A. mellifera Shroom  amShroom        bee
## 14 XP_783573   S. purpuratus Shroom  spShroom sea urchin

Aligning multiple sequences

TODO: in a brief sentence explain what the $ allows us to do

The $ singles out the column “accession” from shroom_table.

shroom_table$accession
##  [1] "CAA78718"  "NP_597713" "CAA58534"  "ABD19518"  "AAF13269"  "AAF13270" 
##  [7] "NP_065910" "ABD59319"  "NP_065768" "AAK95579"  "ABA81834"  "EAA12598" 
## [13] "XP_392427" "XP_783573"

TODO: briefly explain what this chunk is doing and add the correct function

This code creates an object and downloads all 14 sequences.

# add necessary function
shrooms <- rentrez::entrez_fetch         (db = "protein", 
                          id = shroom_table$accession, 
                          rettype = "fasta")

TODO: in a very brief sentence explain what this is doing.

This function prints out shrooms but takes special characters like into consideration and formats the output appropriately.

cat(shrooms)

TODO: in a brief sentence explain what this is doing and if/how its different from the previous code chunks

This code returns a list/vector with the 14 sequences. Entrez_fetch_list is a wrapper function that is a modification of entrez_fetch.

shrooms_list <- entrez_fetch_list(db = "protein", 
                          id = shroom_table$accession, 
                          rettype = "fasta")
is(shrooms_list)
## [1] "list"             "vector"           "list_OR_List"     "vector_OR_Vector"
## [5] "vector_OR_factor"
length(shrooms_list)
## [1] 14
nchar(shrooms_list)
##  CAA78718 NP_597713  CAA58534  ABD19518  AAF13269  AAF13270 NP_065910  ABD59319 
##      1486       915      1673      1543      2083      1895      2070      1864 
## NP_065768  AAK95579  ABA81834  EAA12598 XP_392427 XP_783573 
##      1560       778      1647       750      2230      1758

TODO: briefly explain what I am doing this

This function returns the number of shrooms in shrooms_list.

length(shrooms_list)
## [1] 14

TODO: briefly explain what I am doing this. We will get into the details of for() loops in R later in the semester.

This code runs through each of the 14 sequences in shrooms_list and cleans them.

for(i in 1:length(shrooms_list)){
  shrooms_list[[i]] <- fasta_cleaner(shrooms_list[[i]], parse = F)
}

TODO: summarize what is going on in this code chunk, then annotate each line of code with what its doing

This code chunk is also necessary for cleaning the sequences.

# Replicating NA length(shrooms_list) times
shrooms_vector <- rep(NA, length(shrooms_list))

# Placing the contents of shrooms_list in shrooms_vector.
for(i in 1:length(shrooms_vector)){
  shrooms_vector[i] <- shrooms_list[[i]]
}

#  Gets and sets the names of these objects.
names(shrooms_vector) <- names(shrooms_list)

TODO: explain what this is doing then add the necessary function.

We are converting our shrooms_vector to a string set.

# add necessary function
shrooms_vector_ss <- Biostrings:: AAStringSet       (shrooms_vector)

MSA

TODO: briefly summarize what this section of the document will do.
Readings will be assigned to explain what MSAs are.

This section will perform an alignment of all the sequences of shrooms_vector_ss.

Building a multiple sequence alignment (MSA)

TODO: briefly explain what this chunk does, then add the necessary function.

This chunk performs a multiple sequence alignment on all the sequences of shrooms_vector_ss.

library(msa)
# add necessary function
shrooms_align <- msa(shrooms_vector_ss,
                     method = "ClustalW")
## use default substitution matrix

Viewing an MSA

TODO: briefly summarize what this section will do.

This section will print out the MSA.

Viewing an MSA in R

TODO: Briefly summarize what output is shown below

This output shows sections of our sequences that are similar to each other.

shrooms_align
## CLUSTAL 2.1  
## 
## Call:
##    msa(shrooms_vector_ss, method = "ClustalW")
## 
## MsaAAMultipleAlignment with 14 rows and 2252 columns
##      aln                                                   names
##  [1] -------------------------...------------------------- NP_065768
##  [2] -------------------------...------------------------- AAK95579
##  [3] -------------------------...SVFGGVFPTLTSPL----------- AAF13269
##  [4] -------------------------...SVFGGVFPTLTSPL----------- AAF13270
##  [5] -------------------------...CTFSGIFPTLTSPL----------- NP_065910
##  [6] -------------------------...NKS--LPPPLTSSL----------- ABD59319
##  [7] -------------------------...------------------------- CAA58534
##  [8] -------------------------...------------------------- ABD19518
##  [9] -------------------------...LT----------------------- NP_597713
## [10] -------------------------...------------------------- CAA78718
## [11] -------------------------...------------------------- EAA12598
## [12] -------------------------...------------------------- ABA81834
## [13] MTELQPSPPGYRVQDEAPGPPSCPP...------------------------- XP_392427
## [14] -------------------------...AATSSSSNGIGGPEQLNSNATSSYC XP_783573
##  Con -------------------------...------------------------- Consensus

TODO: briefly explain what is being done in this chunk. This is tricky (and annoying) so do your best

This is more data preparation. Class() prints the class shrooms_align is in. msaConvert converts an msa object to formats used in other sequence analysis packages.

# WHAT IS THE LINE BELOW DOING? (its tricky - do your best)
class(shrooms_align) <- "AAMultipleAlignment"

# WHAT IS THE LINE BELOW DOING? This is simpler
shrooms_align_seqinr <- msaConvert(shrooms_align, type = "seqinr::alignment")

TODO: what is the output this produces

This code prints out our msa.

print_msa(alignment = shrooms_align_seqinr, 
          chunksize = 60)

Displaying an MSA XXXXXXXX

TODO: explain this output and how its differnet from the prevoius

This code plots our msa.

library(ggmsa)
## add necessary function
ggmsa::ggmsa(shrooms_align,   # shrooms_align, NOT shrooms_align_seqinr
      start = 2000, 
      end = 2100)

Saving an MSA as PDF

TODO: explain what this command is doing. Add the package the function is coming from using :: notation This may not work for everyone. If its not working you can comment it out.

This command creates a highly customizable plot for our msa.

#msaPrettyPrint(shrooms_align,             # alignment
               #file = "shroom_msa.pdf",   # file name
               #y=c(2000, 2100),           # range
              # askForOverwrite=FALSE)

TODO: explain what this command is doing

This command returns our working directory.

getwd()
## [1] "C:/Users/annwa/Downloads"