Assignment: Your assignment is to use your notes from class - along with help from classmates, UTAs, and me - to turn this script into a fleshed-out description of what is going on.

This is a substantial project - we’ll work on it in steps over the rest of the unit.

We are currently focused on the overall process and will cover the details over the rest of this unit.

Your first assignment is to get this script to run from top to bottom by adding all of the missing R commands. Once you have done that, you can knit it into an HTML file and upload it to RPubs. (Note - you’ll need to add the YAML header!)

Your second assignment, which will be posted later, is to answer all the TODO and other prompts to add information. You can start on this, but you don’t have to do this on your first time through the code.

Delete all the prompts like TODO() as you compete them. Use RStudio’s search function to see if you’ve missed any - there are a LOT!

A complete bioinformatics workflow in R

By: Nathan L. Brouwer

“Worked example: Building a phylogeny in R”

Introduction

Describe how phylogeneies can be used in biology (readings will be assigned) - It can be used how to use R.Markdown - Create a phlyogenetic tree for the shroom family - Provides a framework for alternative ways of looking at biodiversity.

Vocab

Acession number- unique number assigned by a particular database as an additional means to find the article. Fasta File: test-based format for representing either nucleotide sequences or amino acid sequences. Pairwise Alignment: Identify regions of similarity between Fasta Files. MSA(Multiple Sequence Alignment): Maximize the similarity between Files. Distance Matrix: Summarize Reproducible work flow: R code that can be adaptable to compute. :: -> get the function from that package slash n : creates a new line; new line character

Key functions

Make a list of at least 5 key functions Put in the format of package::function # github packages #library(compbio4all)

CRAN packages

#library(rentrez) #library(seqinr) #library(ape)

Bioconductor packages

#library(msa) #library(Biostrings)

Software Preliminaires

Add the necessary calls to library() to load call packages Indicate which packages came from Bioconductor, CRAN, and GitHub

Load packages into memory

# github packages
library(compbio4all)


# CRAN packages
library(rentrez)
library(seqinr)
library(ape)

# Bioconductor packages
library(msa)
library(Biostrings)

Downloading macromolecular sequences

Passing unique identifiers to an NCBI database and received data files in a variety of formats. db is a character, name of the database to use; id is a vector, a unique IDs for records in database db; rettype(return type) is a character that formats in which to get the data.

# Human shroom 3 (H. sapiens)
hShroom3 <- rentrez::entrez_fetch(db = "protein", 
                          id = "NP_065910", 
                          rettype = "fasta")

cat() function respects the new line character.

cat(hShroom3)

## >NP_065910.3 protein Shroom3 [Homo sapiens]
## MMRTTEDFHKPSATLNSNTATKGRYIYLEAFLEGGAPWGFTLKGGLEHGEPLIISKVEEGGKADTLSSKL
## QAGDEVVHINEVTLSSSRKEAVSLVKGSYKTLRLVVRRDVCTDPGHADTGASNFVSPEHLTSGPQHRKAA
## WSGGVKLRLKHRRSEPAGRPHSWHTTKSGEKQPDASMMQISQGMIGPPWHQSYHSSSSTSDLSNYDHAYL
## RRSPDQCSSQGSMESLEPSGAYPPCHLSPAKSTGSIDQLSHFHNKRDSAYSSFSTSSSILEYPHPGISGR
## ERSGSMDNTSARGGLLEGMRQADIRYVKTVYDTRRGVSAEYEVNSSALLLQGREARASANGQGYDKWSNI
## PRGKGVPPPSWSQQCPSSLETATDNLPPKVGAPLPPARSDSYAAFRHRERPSSWSSLDQKRLCRPQANSL
## GSLKSPFIEEQLHTVLEKSPENSPPVKPKHNYTQKAQPGQPLLPTSIYPVPSLEPHFAQVPQPSVSSNGM
## LYPALAKESGYIAPQGACNKMATIDENGNQNGSGRPGFAFCQPLEHDLLSPVEKKPEATAKYVPSKVHFC
## SVPENEEDASLKRHLTPPQGNSPHSNERKSTHSNKPSSHPHSLKCPQAQAWQAGEDKRSSRLSEPWEGDF
## QEDHNANLWRRLEREGLGQSLSGNFGKTKSAFSSLQNIPESLRRHSSLELGRGTQEGYPGGRPTCAVNTK
## AEDPGRKAAPDLGSHLDRQVSYPRPEGRTGASASFNSTDPSPEEPPAPSHPHTSSLGRRGPGPGSASALQ
## GFQYGKPHCSVLEKVSKFEQREQGSQRPSVGGSGFGHNYRPHRTVSTSSTSGNDFEETKAHIRFSESAEP
## LGNGEQHFKNGELKLEEASRQPCGQQLSGGASDSGRGPQRPDARLLRSQSTFQLSSEPEREPEWRDRPGS
## PESPLLDAPFSRAYRNSIKDAQSRVLGATSFRRRDLELGAPVASRSWRPRPSSAHVGLRSPEASASASPH
## TPRERHSVTPAEGDLARPVPPAARRGARRRLTPEQKKRSYSEPEKMNEVGIVEEAEPAPLGPQRNGMRFP
## ESSVADRRRLFERDGKACSTLSLSGPELKQFQQSALADYIQRKTGKRPTSAAGCSLQEPGPLRERAQSAY
## LQPGPAALEGSGLASASSLSSLREPSLQPRREATLLPATVAETQQAPRDRSSSFAGGRRLGERRRGDLLS
## GANGGTRGTQRGDETPREPSSWGARAGKSMSAEDLLERSDVLAGPVHVRSRSSPATADKRQDVLLGQDSG
## FGLVKDPCYLAGPGSRSLSCSERGQEEMLPLFHHLTPRWGGSGCKAIGDSSVPSECPGTLDHQRQASRTP
## CPRPPLAGTQGLVTDTRAAPLTPIGTPLPSAIPSGYCSQDGQTGRQPLPPYTPAMMHRSNGHTLTQPPGP
## RGCEGDGPEHGVEEGTRKRVSLPQWPPPSRAKWAHAAREDSLPEESSAPDFANLKHYQKQQSLPSLCSTS
## DPDTPLGAPSTPGRISLRISESVLRDSPPPHEDYEDEVFVRDPHPKATSSPTFEPLPPPPPPPPSQETPV
## YSMDDFPPPPPHTVCEAQLDSEDPEGPRPSFNKLSKVTIARERHMPGAAHVVGSQTLASRLQTSIKGSEA
## ESTPPSFMSVHAQLAGSLGGQPAPIQTQSLSHDPVSGTQGLEKKVSPDPQKSSEDIRTEALAKEIVHQDK
## SLADILDPDSRLKTTMDLMEGLFPRDVNLLKENSVKRKAIQRTVSSSGCEGKRNEDKEAVSMLVNCPAYY
## SVSAPKAELLNKIKEMPAEVNEEEEQADVNEKKAELIGSLTHKLETLQEAKGSLLTDIKLNNALGEEVEA
## LISELCKPNEFDKYRMFIGDLDKVVNLLLSLSGRLARVENVLSGLGEDASNEERSSLYEKRKILAGQHED
## ARELKENLDRRERVVLGILANYLSEEQLQDYQHFVKMKSTLLIEQRKLDDKIKLGQEQVKCLLESLPSDF
## IPKAGALALPPNLTSEPIPAGGCTFSGIFPTLTSPL

Retrieving data files of the shroom protein in Mouse, Human, Sea- urchin from the NCBL database and assigning it to respective variables.

# Mouse shroom 3a (M. musculus)
mShroom3a <- entrez_fetch(db = "protein", 
                          id = "AAF13269", 
                          rettype = "fasta")

# Human shroom 2 (H. sapiens)
hShroom2 <- entrez_fetch(db = "protein", 
                          id = "CAA58534", 
                          rettype = "fasta")


# Sea-urchin shroom
sShroom <- entrez_fetch(db = "protein", 
                          id = "XP_783573", 
                          rettype = "fasta")

nchar is a function that displays the number of characters in a vector. In this case, it counts the number of amino acids in the respective shroom genes and includes the slash n.

nchar(hShroom3)

## [1] 2070

nchar(mShroom3a)

## [1] 2083

nchar(sShroom)

## [1] 1758

nchar(hShroom2)

## [1] 1673

Prepping macromolecular sequences

This is a clean up function being downloading into the R session for usage.

fasta_cleaner

## function (fasta_object, parse = TRUE) 
## {
##     fasta_object <- sub("^(>)(.*?)(\\n)(.*)(\\n\\n)", "\\4", 
##         fasta_object)
##     fasta_object <- gsub("\n", "", fasta_object)
##     if (parse == TRUE) {
##         fasta_object <- stringr::str_split(fasta_object, pattern = "", 
##             simplify = FALSE)
##     }
##     return(fasta_object[[1]])
## }
## <bytecode: 0x000000002309f818>
## <environment: namespace:compbio4all>

You can copy and paste the entire function that is assigned to fasta_cleaner to the R script and run it; this is how the function can be run in the R session without downloading compbio4all.

fasta_cleaner <- function(fasta_object, parse = TRUE){

  fasta_object <- sub("^(>)(.*?)(\\n)(.*)(\\n\\n)","\\4",fasta_object)
  fasta_object <- gsub("\n", "", fasta_object)

  if(parse == TRUE){
    fasta_object <- stringr::str_split(fasta_object,
                                       pattern = "",
                                       simplify = FALSE)
  }

  return(fasta_object[[1]])
}

This code chunk is cleaning up the fasta files that were previously created in hShroom3, mShroom3a, aShroom, and hShroom2

hShroom3  <- fasta_cleaner(hShroom3,  parse = F)
mShroom3a <- fasta_cleaner(mShroom3a, parse = F)
hShroom2  <- fasta_cleaner(hShroom2,  parse = F)
sShroom   <- fasta_cleaner(sShroom,   parse = F)

This is displaying what the variable hShroom3 consist of.

hShroom3

## [1] "MMRTTEDFHKPSATLNSNTATKGRYIYLEAFLEGGAPWGFTLKGGLEHGEPLIISKVEEGGKADTLSSKLQAGDEVVHINEVTLSSSRKEAVSLVKGSYKTLRLVVRRDVCTDPGHADTGASNFVSPEHLTSGPQHRKAAWSGGVKLRLKHRRSEPAGRPHSWHTTKSGEKQPDASMMQISQGMIGPPWHQSYHSSSSTSDLSNYDHAYLRRSPDQCSSQGSMESLEPSGAYPPCHLSPAKSTGSIDQLSHFHNKRDSAYSSFSTSSSILEYPHPGISGRERSGSMDNTSARGGLLEGMRQADIRYVKTVYDTRRGVSAEYEVNSSALLLQGREARASANGQGYDKWSNIPRGKGVPPPSWSQQCPSSLETATDNLPPKVGAPLPPARSDSYAAFRHRERPSSWSSLDQKRLCRPQANSLGSLKSPFIEEQLHTVLEKSPENSPPVKPKHNYTQKAQPGQPLLPTSIYPVPSLEPHFAQVPQPSVSSNGMLYPALAKESGYIAPQGACNKMATIDENGNQNGSGRPGFAFCQPLEHDLLSPVEKKPEATAKYVPSKVHFCSVPENEEDASLKRHLTPPQGNSPHSNERKSTHSNKPSSHPHSLKCPQAQAWQAGEDKRSSRLSEPWEGDFQEDHNANLWRRLEREGLGQSLSGNFGKTKSAFSSLQNIPESLRRHSSLELGRGTQEGYPGGRPTCAVNTKAEDPGRKAAPDLGSHLDRQVSYPRPEGRTGASASFNSTDPSPEEPPAPSHPHTSSLGRRGPGPGSASALQGFQYGKPHCSVLEKVSKFEQREQGSQRPSVGGSGFGHNYRPHRTVSTSSTSGNDFEETKAHIRFSESAEPLGNGEQHFKNGELKLEEASRQPCGQQLSGGASDSGRGPQRPDARLLRSQSTFQLSSEPEREPEWRDRPGSPESPLLDAPFSRAYRNSIKDAQSRVLGATSFRRRDLELGAPVASRSWRPRPSSAHVGLRSPEASASASPHTPRERHSVTPAEGDLARPVPPAARRGARRRLTPEQKKRSYSEPEKMNEVGIVEEAEPAPLGPQRNGMRFPESSVADRRRLFERDGKACSTLSLSGPELKQFQQSALADYIQRKTGKRPTSAAGCSLQEPGPLRERAQSAYLQPGPAALEGSGLASASSLSSLREPSLQPRREATLLPATVAETQQAPRDRSSSFAGGRRLGERRRGDLLSGANGGTRGTQRGDETPREPSSWGARAGKSMSAEDLLERSDVLAGPVHVRSRSSPATADKRQDVLLGQDSGFGLVKDPCYLAGPGSRSLSCSERGQEEMLPLFHHLTPRWGGSGCKAIGDSSVPSECPGTLDHQRQASRTPCPRPPLAGTQGLVTDTRAAPLTPIGTPLPSAIPSGYCSQDGQTGRQPLPPYTPAMMHRSNGHTLTQPPGPRGCEGDGPEHGVEEGTRKRVSLPQWPPPSRAKWAHAAREDSLPEESSAPDFANLKHYQKQQSLPSLCSTSDPDTPLGAPSTPGRISLRISESVLRDSPPPHEDYEDEVFVRDPHPKATSSPTFEPLPPPPPPPPSQETPVYSMDDFPPPPPHTVCEAQLDSEDPEGPRPSFNKLSKVTIARERHMPGAAHVVGSQTLASRLQTSIKGSEAESTPPSFMSVHAQLAGSLGGQPAPIQTQSLSHDPVSGTQGLEKKVSPDPQKSSEDIRTEALAKEIVHQDKSLADILDPDSRLKTTMDLMEGLFPRDVNLLKENSVKRKAIQRTVSSSGCEGKRNEDKEAVSMLVNCPAYYSVSAPKAELLNKIKEMPAEVNEEEEQADVNEKKAELIGSLTHKLETLQEAKGSLLTDIKLNNALGEEVEALISELCKPNEFDKYRMFIGDLDKVVNLLLSLSGRLARVENVLSGLGEDASNEERSSLYEKRKILAGQHEDARELKENLDRRERVVLGILANYLSEEQLQDYQHFVKMKSTLLIEQRKLDDKIKLGQEQVKCLLESLPSDFIPKAGALALPPNLTSEPIPAGGCTFSGIFPTLTSPL"

Aligning sequences

This lines up the sequences of human shroom3 and mice.

# add necessary function
align.h3.vs.m3a <- Biostrings:: pairwiseAlignment (
                  hShroom3,
                  mShroom3a)

This object shows the comparison of the different functions of shrooms.

align.h3.vs.m3a

## Global PairwiseAlignmentsSingleSubject (1 of 1)
## pattern: MMRTTEDFHKPSATLN-SNTATKGRYIYLEAFLE...KAGALALPPNLTSEPIPAGGCTFSGIFPTLTSPL
## subject: MK-TPENLEEPSATPNPSRTPTE-RFVYLEALLE...KAGAISLPPALTGHATPGGTSVFGGVFPTLTSPL
## score: 2189.934

pid stands for “percent identity” and it counts the identical bases between human shroom 3 and mouse shroom 3a.

# add necessary function
Biostrings:: pid(align.h3.vs.m3a)

## [1] 70.56511

This code chunk is also comparing the human shroom 3 and mouse protein, but the pairwise alignment is used for specific comparison; alignment of 2 sequences.

align.h3.vs.h2 <- Biostrings::pairwiseAlignment(
                  hShroom3,
                  hShroom2)

This chunk of code is calculating the similarities between sequences, the identical bases, but not indels(insertions/deletions), while the pairwise alignment is used for specific comparison; alignment of 2 sequences. Compares scores and gives the summary of quality of alignment.

score(align.h3.vs.h2)

## [1] -5673.853

The score() calculates the similarities between sequences including identical bases, but not indels(insertions/deletions), while pid() shows the percentage of identical bases and does not include indels.

Biostrings::pid(align.h3.vs.h2)

## [1] 33.83277

The shroom family of genes

The whole table is here because in order to make a table you have to input the data into a vector.

shroom_table <- c("CAA78718" , "X. laevis Apx" ,         "xShroom1",
            "NP_597713" , "H. sapiens APXL2" ,     "hShroom1",
            "CAA58534" , "H. sapiens APXL",        "hShroom2",
            "ABD19518" , "M. musculus Apxl" ,      "mShroom2",
            "AAF13269" , "M. musculus ShroomL" ,   "mShroom3a",
            "AAF13270" , "M. musculus ShroomS" ,   "mShroom3b",
            "NP_065910", "H. sapiens Shroom" ,     "hShroom3",
            "ABD59319" , "X. laevis Shroom-like",  "xShroom3",
            "NP_065768", "H. sapiens KIAA1202" ,   "hShroom4a",
            "AAK95579" , "H. sapiens SHAP-A" ,     "hShroom4b",
            #"DQ435686" , "M. musculus KIAA1202" ,  "mShroom4",
            "ABA81834" , "D. melanogaster Shroom", "dmShroom",
            "EAA12598" , "A. gambiae Shroom",      "agShroom",
            "XP_392427" , "A. mellifera Shroom" ,  "amShroom",
            "XP_783573" , "S. purpuratus Shroom" , "spShroom") #sea urchin

Converting data assigned to shroom_table into different data structures to create finalized table for display.

# convert to matrix
shroom_table_matrix <- matrix(shroom_table,
                                  byrow = T,
                                  nrow = 14)
# convert to data frame
shroom_table <- data.frame(shroom_table_matrix, 
                     stringsAsFactors = F)

# naming columns
names(shroom_table) <- c("accession", "name.orig","name.new")

# Create simplified species names
shroom_table$spp <- "Homo"
shroom_table$spp[grep("laevis",shroom_table$name.orig)] <- "Xenopus"
shroom_table$spp[grep("musculus",shroom_table$name.orig)] <- "Mus"
shroom_table$spp[grep("melanogaster",shroom_table$name.orig)] <- "Drosophila"
shroom_table$spp[grep("gambiae",shroom_table$name.orig)] <- "mosquito"
shroom_table$spp[grep("mellifera",shroom_table$name.orig)] <- "bee"
shroom_table$spp[grep("purpuratus",shroom_table$name.orig)] <- "sea urchin"

This is displaying what consists inside of shroom_table; the organized table from the previous code chunk and categorized by the given column names.

shroom_table

##    accession              name.orig  name.new        spp
## 1   CAA78718          X. laevis Apx  xShroom1    Xenopus
## 2  NP_597713       H. sapiens APXL2  hShroom1       Homo
## 3   CAA58534        H. sapiens APXL  hShroom2       Homo
## 4   ABD19518       M. musculus Apxl  mShroom2        Mus
## 5   AAF13269    M. musculus ShroomL mShroom3a        Mus
## 6   AAF13270    M. musculus ShroomS mShroom3b        Mus
## 7  NP_065910      H. sapiens Shroom  hShroom3       Homo
## 8   ABD59319  X. laevis Shroom-like  xShroom3    Xenopus
## 9  NP_065768    H. sapiens KIAA1202 hShroom4a       Homo
## 10  AAK95579      H. sapiens SHAP-A hShroom4b       Homo
## 11  ABA81834 D. melanogaster Shroom  dmShroom Drosophila
## 12  EAA12598      A. gambiae Shroom  agShroom   mosquito
## 13 XP_392427    A. mellifera Shroom  amShroom        bee
## 14 XP_783573   S. purpuratus Shroom  spShroom sea urchin

Aligning multiple sequences

$ allows you to access variable with that particular data set; it takes accession numbers, gives it entrez and get sequences.

shroom_table$accession

##  [1] "CAA78718"  "NP_597713" "CAA58534"  "ABD19518"  "AAF13269"  "AAF13270" 
##  [7] "NP_065910" "ABD59319"  "NP_065768" "AAK95579"  "ABA81834"  "EAA12598" 
## [13] "XP_392427" "XP_783573"

This chunk is retrieving all the proteins’ accession numbers in the NCBI database, returning it as a fasta file, and assigning it to shrooms.

# add necessary function
shrooms <-rentrez::entrez_fetch(db = "protein", 
                          id = shroom_table$accession, 
                          rettype = "fasta")

Enforces new line when printing shroom proteins to file and gets one fasta file of a shroom protein and attach it to end of the previous one after it was downloaded.

cat(shrooms)

This is a wrapper function that “wraps” around other programs components; gets all accession numbers from sequences in the shroom_table and returns it as a fasta file. Shrooms and shrooms_list are slightly different because shrooms_list processes multiple NCBI accessions and outputs it as a list, while shrooms is downloads just one databases.

shrooms_list <- compbio4all::entrez_fetch_list(db = "protein", 
                          id = shroom_table$accession, 
                          rettype = "fasta")

TODO: briefly explain what I am doing this

is(shrooms_list)

## [1] "list"             "vector"           "list_OR_List"     "vector_OR_Vector"
## [5] "vector_OR_factor"

length(shrooms_list)

## [1] 14

nchar(shrooms_list)

##  CAA78718 NP_597713  CAA58534  ABD19518  AAF13269  AAF13270 NP_065910  ABD59319 
##      1486       915      1673      1543      2083      1895      2070      1864 
## NP_065768  AAK95579  ABA81834  EAA12598 XP_392427 XP_783573 
##      1560       778      1647       750      2230      1758

TODO: briefly explain what I am doing this. We will get into the details of for() loops in R later in the semester.

for(i in 1:length(shrooms_list)){
  shrooms_list[[i]] <- fasta_cleaner(shrooms_list[[i]], parse = F)
}

TODO: summarize what is going on in this code chunk, then annotate each line of code with what its doing

# XXXXXXXXCX
shrooms_vector <- rep(NA, length(shrooms_list))

# XXXXXXXXCX
for(i in 1:length(shrooms_vector)){
  shrooms_vector[i] <- shrooms_list[[i]]
}

#  XXXXXXXXCX
names(shrooms_vector) <- names(shrooms_list)

TODO: explain what this is doing then add the necessary function.

# add necessary function
shrooms_vector_ss <- Biostrings::AAStringSet(shrooms_vector)

MSA

TODO: briefly summarize what this section of the document will do.
Readings will be assigned to explain what MSAs are.

Building an XXXXXXXX (MSA)

TODO: briefly explain what this chunk does, then add the necessary function.

# add necessary function
shrooms_align <-msa(shrooms_vector_ss,
                     method = "ClustalW")

## use default substitution matrix

Viewing an MSA

TODO: briefly summarize what this section will do.

Viewing an MSA in R

TODO: Briefly summarize what output is shown below

shrooms_align

## CLUSTAL 2.1  
## 
## Call:
##    msa(shrooms_vector_ss, method = "ClustalW")
## 
## MsaAAMultipleAlignment with 14 rows and 2252 columns
##      aln                                                   names
##  [1] -------------------------...------------------------- NP_065768
##  [2] -------------------------...------------------------- AAK95579
##  [3] -------------------------...SVFGGVFPTLTSPL----------- AAF13269
##  [4] -------------------------...SVFGGVFPTLTSPL----------- AAF13270
##  [5] -------------------------...CTFSGIFPTLTSPL----------- NP_065910
##  [6] -------------------------...NKS--LPPPLTSSL----------- ABD59319
##  [7] -------------------------...------------------------- CAA58534
##  [8] -------------------------...------------------------- ABD19518
##  [9] -------------------------...LT----------------------- NP_597713
## [10] -------------------------...------------------------- CAA78718
## [11] -------------------------...------------------------- EAA12598
## [12] -------------------------...------------------------- ABA81834
## [13] MTELQPSPPGYRVQDEAPGPPSCPP...------------------------- XP_392427
## [14] -------------------------...AATSSSSNGIGGPEQLNSNATSSYC XP_783573
##  Con -------------------------...------------------------- Consensus

TODO: briefly explain what is being done in this chunk. This is tricky (and annoying) so do your best

# WHAT IS THE LINE BELOW DOING? (its tricky - do your best)
class(shrooms_align) <- "AAMultipleAlignment"

# WHAT IS THE LINE BELOW DOING? This is simpler
shrooms_align_seqinr <- msaConvert(shrooms_align, type = "seqinr::alignment")

TODO: what is the output this produces

print_msa(alignment = shrooms_align_seqinr, 
          chunksize = 60)

Displaying an MSA XXXXXXXX

TODO: explain this output and how its different from the previous

## add necessary function
ggmsa:: ggmsa(shrooms_align,   # shrooms_align, NOT shrooms_align_seqinr
      start = 2000, 
      end = 2100)

## Registered S3 methods overwritten by 'ggalt':
##   method                  from   
##   grid.draw.absoluteGrob  ggplot2
##   grobHeight.absoluteGrob ggplot2
##   grobWidth.absoluteGrob  ggplot2
##   grobX.absoluteGrob      ggplot2
##   grobY.absoluteGrob      ggplot2

Saving an MSA as PDF

TODO: explain what this command is doing. Add the package the function is coming from using :: notation This may not work for everyone. If its not working you can comment it out.

msaPrettyPrint(shrooms_align,             # alignment
               file = "shroom_msa.pdf",   # file name
               y=c(2000, 2100),           # range
               askForOverwrite=FALSE)

TODO: explain what this command is doing. Running every single line of code.

getwd()

## [1] "C:/Users/leila/Downloads"

A Bioinformatic Flow

Leila Dean Stansberry

9/28/2021