R Notebook: Provides reproducible analysis for Gain-of-function (GOF) Analysis in the following manuscript:
Citation: Lippert LB, Hinton SR, Holston A, Romanowicz KJ, Plesa C. Characterizing Sequence-Function Relationships in Chimeric DcuS/EnvZ Histidine Kinases. In Prep. 2026.
GitHub Repository: https://github.com/PlesaLab/DcuSEnvZ
This pipeline processes barcode-sequence-phenotype data previously generated in Merge_and_MEFL_Convert.Rmd. and determines positions which are significantly enriched for influencing aspartate responsiveness and specificity based on the total number of barcodes observed.
The following R packages must be installed prior to loading into the R session. See the Reproducibility tab for a complete list of packages and their versions used in this workflow.
# Make a vector of required packages
required.packages <- c("devtools", "knitr", "patchwork", "tidyverse", "ggplot2", "dplyr", "tidyr", "magrittr", "stringr", "seqinr", "ggrepel", "ggExtra")
# Load required packages
lapply(required.packages, library, character.only = TRUE)
This section is based on the R file: “GOF_Analysis.R”. It describes how to load all of the pre-existing barcode-sequence-phenotype data necessary for downstream analysis. The end result is two scatter plots showing the number of filtered barcodes observed at each position and three additional visualizations for the positions which were found to be significantly enriched for two phenotypes: aspartate responsiveness and specificity.
merged_BC_MEFL_norm <- read.csv(file="./output_files/All_DcuS_Data-medianMEFL.csv", head=T, sep=",")
…the data to associate phenotype with the specific amino acid mutation found in mutant sequences.
For each mutant DcuS sequence, align it to wild-type sequence and determine which amino acids differ. Record three columns: amino acid, position, mutation
# make a vector of the wild-type sequence to compare mutant sequences to
wt_seq = "RHSLPYRMLRKRPMKLSTTVILMVSAVLFSVLLVVHLIYFSQISDMTRDGLANKALAVARTLADSPEIRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHPEAQRIGQPFKGDDILKALNGEENVAINRGFLAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQINDSRWSLQMAAGVKQLA"
# WT sequence as a vector
wt_seq_vec <- str_split(wt_seq, "")[[1]]
# custom mutation parser
find_mutations <- function(mut_seq) {
mut_vec <- str_split(mut_seq, "")[[1]]
# safety check
if (length(mut_vec) != length(wt_seq_vec)) {
return(NA_character_)
}
diff_pos <- which(mut_vec != wt_seq_vec)
# no mutations
if (length(diff_pos) == 0) {
return(NA_character_)
}
# output of the function:
paste0(
wt_seq_vec[diff_pos],
diff_pos +1,
mut_vec[diff_pos],
collapse = "_"
)
}
single_mutations <- merged_BC_MEFL_norm %>%
# Filter to only keep mutants that are the correct AA length (192 amino acids)
filter(AAlen==192) %>%
# Create the mutation identifier string
mutate(mutations = sapply(AAseq, find_mutations)) %>%
# Remove wildtype data
filter(!is.na(mutations)) %>%
# Keep only single mutants
filter(str_length(mutations) <= 5) %>%
# extract out the mutation information for easier visualization/collapse
tidyr::extract(mutations,
into = c("wildtype", "position", "mutant"),
regex = "^([A-Z])([0-9]+)([A-Z])$",
convert = TRUE) %>%
# Re-create the mutation identifer string for downstream use
mutate(mutation = paste0(wildtype, position, mutant, sep=""))
Define dynamic range of wildtype to both ligands, this will serve as a useful benchmark with which to filer the mutant data
wt_data <- merged_BC_MEFL_norm %>%
filter(AAseq==wt_seq)
NoLig_WTmed = median(wt_data$NoLig_Median_MEFL)
Fum_WTmed = median(wt_data$Fum_Median_MEFL)
Asp_WTmed = median(wt_data$Asp_Median_MEFL)
WT_Fum_DNR = log2(Fum_WTmed/NoLig_WTmed)
WT_Asp_DNR = log2(Asp_WTmed/NoLig_WTmed)
To determine positions which are enriched for influencing responsiveness to aspartate, we will first filter the dataset to keep only single mutants with an aspartate dynamic range greater than the wildtype aspartate dynamic range. As seen above, dynamic range (DNR) is defined here as the following:
\(DNR = log_2(Lig.MEFL / NoLig. MEFL)\)
Next, we will collapse the data by position and keep the total number of unique barcodes, unique mutant residues, and average phenotype scores for each position. Then we will plot the number of observed (at this point, filtered as well) barcodes over position. Positions with barcode counts greater than two standard deviations plus the mean of the dataset will be considered significant.
For aspartate dynamic range, we will infer improved responsiveness based on if the absolute value of aspartate dynamic range is improved. This is because some mutants within the dataset have negative dynamic range values for aspartate, and this is still a response, even if it is in the opposite direction (lower fluorescence when ligand is present) than what we would typically expect for an aspartate biosensor.
Filter the dataset:
aspDNR_abs <- single_mutations %>%
# calculate the absolute value of Asp DNR
mutate(Asp_dnr_ABSVal = abs(Asp_DNR)) %>%
# first collapse by amino acid sequence and compute some summary statistics
group_by(AAseq) %>%
summarize(n_barcodes = n_distinct(barcode),
AAseq_count = n(),
mutation = dplyr::first(mutation),
wildtype = dplyr::first(wildtype),
position = dplyr::first(position),
mutant = dplyr::first(mutant),
Asp_dnr_ABSVal = mean(Asp_dnr_ABSVal),
NoLig_MEFL_avg = mean(NoLig_Median_MEFL),
Fum_MEFL_avg = mean(Fum_Median_MEFL),
Asp_MEFL_avg = mean(Asp_Median_MEFL),
NoLig_fc = mean(NoLig_fc),
Fum_fc = mean(Fum_fc),
Asp_fc = mean(Asp_fc),
Asp_dnr = mean(Asp_DNR),
Fum_dnr = mean(Fum_DNR),
Lig_spec = mean(Lig_spec)
) %>%
# filter to keep only sequences that have an average absolute aspartate DNR above the observed wildtype aspartate DNR
filter(Asp_dnr_ABSVal >= WT_Asp_DNR)
Collapse by position:
aspDNR_abs_positions <- aspDNR_abs %>%
# collapse by position
group_by(position) %>%
summarize(n_barcodes = sum(n_barcodes),
n_unique_mutations = n_distinct(mutation),
Asp_dnr_ABSVal = mean(Asp_dnr_ABSVal),
Asp_dnr = mean(Asp_dnr),
Fum_dnr = mean(Fum_dnr),
Lig_spec = mean(Lig_spec),
NoLig_fc = mean(NoLig_fc),
Fum_fc = mean(Fum_fc),
Asp_fc = mean(Asp_fc),
NoLig_MEFL_avg = mean(NoLig_MEFL_avg),
Fum_MEFL_avg = mean(Fum_MEFL_avg),
Asp_MEFL_avg = mean(Asp_MEFL_avg)
)
Calculate the barcode count distribution and summary statistics:
aspDNR_abs_BCdist <- aspDNR_abs_positions %>%
group_by(n_barcodes) %>%
summarize(n_observed_positions = n())
# For the purposes of this analysis, we will remove positions 55 and 65 from the summary statistics calculations because they are observed to have much larger barcode counts relative to the rest of the dataset; in short, they are outliers.
aspDNR_abs_positions_rm <- aspDNR_abs_positions %>%
filter(position != 55) %>%
filter(position != 65)
aspDNR_abs_meanBC = mean(aspDNR_abs_positions_rm$n_barcodes, na.rm=T)
aspDNR_abs_sdBC = sd(aspDNR_abs_positions_rm$n_barcodes, na.rm = TRUE)
aspDNR_abs_mean_sdBC = aspDNR_abs_sdBC + aspDNR_abs_meanBC
aspDNR_abs_mean_sdBC_2 = (2*aspDNR_abs_sdBC) + aspDNR_abs_meanBC
Finally, visualize the results: which positions have a significant number of barcodes associated with increased aspartate dynamic range?
aspDNR_abs_ScatterPlot <- ggplot(data=aspDNR_abs_positions,
aes(x=position, y=n_barcodes, color=n_unique_mutations)) +
geom_point(size=2) +
geom_hline(yintercept = aspDNR_abs_meanBC, linetype="dashed", color="darkblue") +
geom_hline(yintercept = aspDNR_abs_mean_sdBC_2, linetype="dashed", color="red3") +
#annotate("text", x = Inf, y = aspDNR_abs_meanBC,
# label = expression(mu), hjust = 1.1, vjust = -0.5, size = 7) +
# annotate("text", x = Inf, y = aspDNR_abs_mean_sdBC_2,
# label = expression(paste(mu, "+2",sigma)) , hjust = 1.1, vjust = -0.5, size = 7) +
scale_color_gradient2(
low = "blue",
mid = "blue",
high = "red",
midpoint=1,
name = "Num. Uniq. Mut."
) +
labs(x = "Position (aa)",
y = "# barcodes") +
geom_text_repel(
data = subset(aspDNR_abs_positions, n_barcodes >= aspDNR_abs_mean_sdBC_2),
aes(label=position), size=6) +
scale_x_continuous(breaks=seq(0,192,20)) +
scale_y_continuous(breaks=seq(0,260,20)) +
theme_classic() +
theme(
axis.title = element_text(size = 20, face = "bold"),
axis.text.y = element_text(size = 16),
axis.text.x = element_text(size = 16),
legend.title = element_text(size=20),
legend.text = element_text(size = 12),
legend.position="top", legend.justification = "right",
plot.margin = margin(5.5, 0, 5.5, 5.5) # no right margin
)
aspDNR_abs_withMarginal <- ggExtra::ggMarginal(aspDNR_abs_ScatterPlot,
type="histogram",
margins="y",
bins=nrow(aspDNR_abs_BCdist),
col="black",
fill="red")
aspDNR_abs_withMarginal

Next, we will perform the same operations for aspartate specificity. Here, I define aspartate specificity as a ligand specificity score greater than 0, where ligand specificity is the following:
\(Lig. spec. = log_2(Asp. MEFL / Fum. MEFL)\)
First, we will filter the dataset
asp_selec <- single_mutations %>%
# collapse by mutation and calculate the average phenotype scores observed for that position
group_by(mutation) %>%
summarize(
n_barcodes = n_distinct(barcode),
mutation_observed_count = n(),
mutation = dplyr::first(mutation),
wildtype = dplyr::first(wildtype),
position = dplyr::first(position),
mutant = dplyr::first(mutant),
NoLig_MEFL_avg = mean(NoLig_Median_MEFL),
Fum_MEFL_avg = mean(Fum_Median_MEFL),
Asp_MEFL_avg = mean(Asp_Median_MEFL),
NoLig_fc = mean(NoLig_fc),
Fum_fc = mean(Fum_fc),
Asp_fc = mean(Asp_fc),
Fum_dnr_avg = mean(Fum_DNR),
Asp_dnr_avg = mean(Asp_DNR),
Lig_spec_avg = mean(Lig_spec)
) %>%
# filter for ligand specificity scores greater than 0
filter(Lig_spec_avg > 0)
Collapse by position:
asp_selec_positions <- asp_selec %>%
group_by(position) %>%
summarize(
n_mutants = n(),
n_unique_mutations = n_distinct(mutation),
mutation_observed_counts = sum(mutation_observed_count),
n_barcodes = sum(n_barcodes),
NoLig_MEFL_avg = mean(NoLig_MEFL_avg),
Fum_MEFL_avg = mean(Fum_MEFL_avg),
Asp_MEFL_avg = mean(Asp_MEFL_avg),
NoLig_fc = mean(NoLig_fc),
Fum_fc = mean(Fum_fc),
Asp_fc = mean(Asp_fc),
Fum_dnr_avg = mean(Fum_dnr_avg),
Asp_dnr_avg = mean(Asp_dnr_avg),
Lig_spec_avg = mean(Lig_spec_avg)
)
Calculate the barcode count distribution and summary statistics:
asp_selec_BCdist <- asp_selec_positions %>%
group_by(n_barcodes) %>%
summarize(n_observed_positions = n())
asp_selec_positions_rm <- asp_selec_positions %>%
filter(position != 55) %>%
filter(position != 65)
asp_selec_mu = mean(asp_selec_positions_rm$n_barcodes, na.rm=T)
asp_selec_sigma = sd(asp_selec_positions_rm$n_barcodes, na.rm=T)
asp_selec_mu_plus_sigma = asp_selec_mu + asp_selec_sigma
asp_selec_mu_plus_2sigma = asp_selec_mu + (2*asp_selec_sigma)
Finally, visualize the results: which positions have a significant number of barcodes associated with increased aspartate specificity?
asp_selec_ScatterPlot <- ggplot(data=asp_selec_positions,
aes(x=position, y=n_barcodes, color=n_unique_mutations)) +
geom_point(size=2) +
geom_hline(yintercept = asp_selec_mu, linetype="dashed", color="darkblue") +
geom_hline(yintercept = asp_selec_mu_plus_2sigma, linetype="dashed", color="red3") +
scale_color_gradient2(
low = "blue",
mid = "blue",
high = "red",
midpoint=1,
name = "Num. Uniq. Mut."
) +
labs(x = "Position (aa)",
y = "# barcodes") +
geom_text_repel(
data = subset(asp_selec_positions, n_barcodes >= asp_selec_mu_plus_2sigma),
aes(label=position), size=6) +
scale_x_continuous(breaks=seq(0,192,20)) +
scale_y_continuous(breaks=seq(0,260,20)) +
theme_classic() +
theme(
axis.title = element_text(size = 20, face = "bold"),
axis.text.y = element_text(size = 16),
axis.text.x = element_text(size = 16),
legend.title = element_text(size=20),
legend.text = element_text(size = 12),
legend.position="top", legend.justification = "right",
plot.margin = margin(5.5, 0, 5.5, 5.5) # no right margin
)
asp_selec_withMarginal <- ggExtra::ggMarginal(asp_selec_ScatterPlot,
type="histogram",
margins="y",
bins=nrow(asp_selec_BCdist),
col="black",
fill="red")
asp_selec_withMarginal

Next, we will make heatmaps to visualize what the aspartate dynamic range and ligand specificity scores are for the mutants observed for each significant position.
# These are the positions which were the same among the positions identified as significant for both responsiveness and specificity
desired_positions <- c(11, 13, 32, 36, 49, 54, 55, 65, 105, 165, 193)
# Filter for these positions
sig_residues <- single_mutations %>%
filter(position %in% desired_positions) %>%
# Calculate average phenotype scores for the observed mutants at these positions
group_by(mutation) %>%
summarize(n_barcodes = n_distinct(barcode),
AAseq_count = n(),
wildtype = dplyr::first(wildtype),
position = dplyr::first(position),
mutant = dplyr::first(mutant),
NoLig_MEFL_avg = mean(NoLig_Median_MEFL),
Fum_MEFL_avg = mean(Fum_Median_MEFL),
Asp_MEFL_avg = mean(Asp_Median_MEFL),
NoLig_fc = mean(NoLig_fc, na.rm=T),
Fum_fc = mean(Fum_fc, na.rm=T),
Asp_fc = mean(Asp_fc, na.rm=T),
Asp_dynamic_range = mean(Asp_DNR, na.rm=T),
Fum_dynamic_range = mean(Fum_DNR, na.rm=T),
Ligand_specificity = mean(Lig_spec, na.rm=T)
)
Wrangle the data for visualization
# custom ordering of amino acids for heatmaps
ordered_aa <- c("K", "R", "H", "E", "D", "N", "Q", "T", "S", "C", "G", "A", "V", "L", "I", "M", "P", "Y", "F", "W")
position = 2:193
# Make a completed dataframe which will make tiles for mutations not present gray in the resultant heatmap
sig_residues_plot <- sig_residues %>%
complete(
position = full_seq(position, 1),
mutant = ordered_aa
)
# re-order the data to align with custom amino acid order
sig_residues_plot <- sig_residues_plot %>%
mutate(
aa = factor(mutant, levels = ordered_aa),
position = factor(position, levels = desired_positions)
) %>%
filter(position %in% desired_positions)
# calculate averages to add above
averages <- sig_residues_plot %>%
group_by(position) %>%
summarize(
Fum_dnr_avg_score = mean(Fum_dynamic_range, na.rm=T),
Asp_dnr_avg_score = mean(Asp_dynamic_range, na.rm=T),
Lig_spec_avg_score = mean(Ligand_specificity, na.rm=T)
) %>%
mutate(row_id = row_number())
as.numeric(averages$row_id)
## [1] 1 2 3 4 5 6 7 8 9 10 11
Aspartate dynamic range heatmap
ggplot(sig_residues_plot, aes(x = position, y = aa, fill = Asp_dynamic_range, label=n_barcodes)) +
geom_tile() +
geom_text(size = 5) +
scale_fill_gradient2(low = "blue", high = "red", mid="gold",midpoint=0, name="DNR",
na.value="gray") +
geom_segment(aes(x=1, y=22,xend = 8, yend=22), colour="gray0")+
geom_rect(data=averages, aes(xmin=row_id-0.5,xmax=row_id+0.5, ymin=21.5, ymax=22.5, fill=Asp_dnr_avg_score), inherit.aes = FALSE) +
labs( title = "Aspartate Responsiveness",
x = "Position (aa)",
y = "Amino Acid",
fill = "DNR"
) +
theme_minimal() +
theme(
plot.title = element_text(size = 22, face = "bold"),
axis.title = element_text(size = 20),
axis.text.x = element_text(size = 16),
axis.text.y = element_text(size = 16),
legend.text = element_text(size = 12),
legend.title = element_text(size = 16),
panel.grid = element_blank(),
legend.position="top", legend.justification="right"
)
## Warning: Removed 170 rows containing missing values or values outside the scale range
## (`geom_text()`).

Fumarate dynamic range heatmap
ggplot(sig_residues_plot, aes(x = position, y = aa, fill = Fum_dynamic_range, label=n_barcodes)) +
geom_tile() +
geom_text(size = 5) +
scale_fill_gradient2(low = "blue", high = "red", mid="gold",midpoint=0, name="DNR",
na.value="gray") +
geom_segment(aes(x=1, y=22,xend = 8, yend=22), colour="gray0")+
geom_rect(data=averages, aes(xmin=row_id-0.5,xmax=row_id+0.5, ymin=21.5, ymax=22.5, fill=Fum_dnr_avg_score), inherit.aes = FALSE) +
labs( title = "Fumarate Responsiveness",
x = "Position (aa)",
y = "Amino Acid",
fill = "DNR"
) +
theme_minimal() +
theme(
plot.title = element_text(size = 22, face = "bold"),
axis.title = element_text(size = 20),
axis.text.x = element_text(size = 16),
axis.text.y = element_text(size = 16),
legend.text = element_text(size = 12),
legend.title = element_text(size = 16),
panel.grid = element_blank(),
legend.position="top", legend.justification="right"
)
## Warning: Removed 170 rows containing missing values or values outside the scale range
## (`geom_text()`).
Ligand specificity heatmap
ggplot(sig_residues_plot, aes(x = position, y = aa, fill = Ligand_specificity, label=n_barcodes)) +
geom_tile() +
geom_text(size = 5) +
scale_fill_gradient2(low = "blue", high = "red", mid="gold",midpoint=0, name="Lig. Spec.",
na.value="gray") +
geom_segment(aes(x=1, y=22,xend = 8, yend=22), colour="gray0")+
geom_rect(data=averages, aes(xmin=row_id-0.5,xmax=row_id+0.5, ymin=21.5, ymax=22.5, fill=Lig_spec_avg_score), inherit.aes = FALSE) +
labs( title = "Aspartate Specificity",
x = "Position (aa)",
y = "Amino Acid",
fill = "Lig. Spec."
) +
theme_minimal() +
theme(
plot.title = element_text(size = 22, face = "bold"),
axis.title = element_text(size = 20),
axis.text.x = element_text(size = 16),
axis.text.y = element_text(size = 16),
legend.text = element_text(size = 12),
legend.title = element_text(size = 16),
panel.grid = element_blank(),
legend.position="top", legend.justification="right"
)
## Warning: Removed 170 rows containing missing values or values outside the scale range
## (`geom_text()`).
How do aspartate dynamic range, fumarate dynamic range, and ligand specificity scores relate?
# Scatter plot for correlation between fumarate DNR and aspartate DNR among significant residues
fita <- lm(Fum_dynamic_range ~ Asp_dynamic_range, data = sig_residues) # linear regression, formula = y ~ x
r2a <- summary(fita)$r.squared
ggplot(sig_residues, aes(x=Asp_dynamic_range, y=Fum_dynamic_range)) +
geom_point(aes(fill = Ligand_specificity), shape=21, size=4) +
scale_fill_gradient2(low = "blue", high = "red", mid="gold",midpoint=0, name="Lig. Spec.") +
geom_smooth(
method="lm",
formula = y ~ x,
se = FALSE,
color="gray25"
) +
labs(#title = "Fumarate and Aspartate Dynamic Range values",
#subtitle = "Mutations with Fumarate DNR = 0 removed",
x="Aspartate Dynamic Range",
y="Fumarate Dynamic Range",
) +
annotate(
"text",
x = Inf, y = -Inf,
label = paste0("R² = ", round(r2a, 3)),
hjust = 1.1, vjust = -2,
size = 8
) +
theme_classic() +
theme(
plot.title = element_text(size = 22, face = "bold"),
axis.title = element_text(size = 20),
axis.text.x = element_text(size = 16),
axis.text.y = element_text(size = 16),
legend.text = element_text(size = 12),
legend.title = element_text(size = 16),
panel.grid = element_blank(),
legend.position="top", legend.justification="right"
)
The session information is provided for full reproducibility.
devtools::session_info()
## ─ Session info ───────────────────────────────────────────────────────────────
## setting value
## version R version 4.4.1 (2024-06-14)
## os macOS 15.7.3
## system x86_64, darwin20
## ui X11
## language (EN)
## collate en_US.UTF-8
## ctype en_US.UTF-8
## tz America/Los_Angeles
## date 2026-05-20
## pandoc 3.6.3 @ /Applications/RStudio.app/Contents/Resources/app/quarto/bin/tools/x86_64/ (via rmarkdown)
## quarto 1.7.32 @ /Applications/RStudio.app/Contents/Resources/app/quarto/bin/quarto
##
## ─ Packages ───────────────────────────────────────────────────────────────────
## package * version date (UTC) lib source
## ade4 1.7-23 2025-02-14 [1] CRAN (R 4.4.1)
## bslib 0.10.0 2026-01-26 [1] CRAN (R 4.4.1)
## cachem 1.1.0 2024-05-16 [1] CRAN (R 4.4.0)
## cli 3.6.5 2025-04-23 [1] CRAN (R 4.4.1)
## devtools * 2.4.6 2025-10-03 [1] CRAN (R 4.4.1)
## dichromat 2.0-0.1 2022-05-02 [1] CRAN (R 4.4.0)
## digest 0.6.39 2025-11-19 [1] CRAN (R 4.4.1)
## dplyr * 1.2.0 2026-02-03 [1] CRAN (R 4.4.1)
## ellipsis 0.3.2 2021-04-29 [1] CRAN (R 4.4.0)
## evaluate 1.0.5 2025-08-27 [1] CRAN (R 4.4.1)
## farver 2.1.2 2024-05-13 [1] CRAN (R 4.4.0)
## fastmap 1.2.0 2024-05-15 [1] CRAN (R 4.4.0)
## forcats * 1.0.1 2025-09-25 [1] CRAN (R 4.4.1)
## fs 1.6.6 2025-04-12 [1] CRAN (R 4.4.1)
## generics 0.1.4 2025-05-09 [1] CRAN (R 4.4.1)
## ggExtra * 0.11.0 2025-09-01 [1] CRAN (R 4.4.1)
## ggplot2 * 4.0.2 2026-02-03 [1] CRAN (R 4.4.1)
## ggrepel * 0.9.6 2024-09-07 [1] CRAN (R 4.4.1)
## glue 1.8.0 2024-09-30 [1] CRAN (R 4.4.1)
## gtable 0.3.6 2024-10-25 [1] CRAN (R 4.4.1)
## hms 1.1.4 2025-10-17 [1] CRAN (R 4.4.1)
## htmltools 0.5.9 2025-12-04 [1] CRAN (R 4.4.1)
## httpuv 1.6.16 2025-04-16 [1] CRAN (R 4.4.1)
## jquerylib 0.1.4 2021-04-26 [1] CRAN (R 4.4.0)
## jsonlite 2.0.0 2025-03-27 [1] CRAN (R 4.4.1)
## knitr * 1.51 2025-12-20 [1] CRAN (R 4.4.1)
## labeling 0.4.3 2023-08-29 [1] CRAN (R 4.4.0)
## later 1.4.5 2026-01-08 [1] CRAN (R 4.4.1)
## lattice 0.22-7 2025-04-02 [1] CRAN (R 4.4.1)
## lifecycle 1.0.5 2026-01-08 [1] CRAN (R 4.4.1)
## lubridate * 1.9.5 2026-02-04 [1] CRAN (R 4.4.1)
## magrittr * 2.0.4 2025-09-12 [1] CRAN (R 4.4.1)
## MASS 7.3-65 2025-02-28 [1] CRAN (R 4.4.1)
## Matrix 1.7-4 2025-08-28 [1] CRAN (R 4.4.1)
## memoise 2.0.1 2021-11-26 [1] CRAN (R 4.4.0)
## mgcv 1.9-4 2025-11-07 [1] CRAN (R 4.4.1)
## mime 0.13 2025-03-17 [1] CRAN (R 4.4.1)
## miniUI 0.1.2 2025-04-17 [1] CRAN (R 4.4.1)
## nlme 3.1-168 2025-03-31 [1] CRAN (R 4.4.1)
## otel 0.2.0 2025-08-29 [1] CRAN (R 4.4.1)
## patchwork * 1.3.2 2025-08-25 [1] CRAN (R 4.4.1)
## pillar 1.11.1 2025-09-17 [1] CRAN (R 4.4.1)
## pkgbuild 1.4.8 2025-05-26 [1] CRAN (R 4.4.1)
## pkgconfig 2.0.3 2019-09-22 [1] CRAN (R 4.4.0)
## pkgload 1.5.0 2026-02-03 [1] CRAN (R 4.4.1)
## promises 1.5.0 2025-11-01 [1] CRAN (R 4.4.1)
## purrr * 1.2.1 2026-01-09 [1] CRAN (R 4.4.1)
## R6 2.6.1 2025-02-15 [1] CRAN (R 4.4.1)
## RColorBrewer 1.1-3 2022-04-03 [1] CRAN (R 4.4.0)
## Rcpp 1.1.1 2026-01-10 [1] CRAN (R 4.4.1)
## readr * 2.1.6 2025-11-14 [1] CRAN (R 4.4.1)
## remotes 2.5.0 2024-03-17 [1] CRAN (R 4.4.0)
## rlang 1.1.7 2026-01-09 [1] CRAN (R 4.4.1)
## rmarkdown 2.30 2025-09-28 [1] CRAN (R 4.4.1)
## rstudioapi 0.18.0 2026-01-16 [1] CRAN (R 4.4.1)
## S7 0.2.1 2025-11-14 [1] CRAN (R 4.4.1)
## sass 0.4.10 2025-04-11 [1] CRAN (R 4.4.1)
## scales 1.4.0 2025-04-24 [1] CRAN (R 4.4.1)
## seqinr * 4.2-36 2023-12-08 [1] CRAN (R 4.4.0)
## sessioninfo 1.2.3 2025-02-05 [1] CRAN (R 4.4.1)
## shiny 1.12.1 2025-12-09 [1] CRAN (R 4.4.1)
## stringi 1.8.7 2025-03-27 [1] CRAN (R 4.4.1)
## stringr * 1.6.0 2025-11-04 [1] CRAN (R 4.4.1)
## tibble * 3.3.1 2026-01-11 [1] CRAN (R 4.4.1)
## tidyr * 1.3.2 2025-12-19 [1] CRAN (R 4.4.1)
## tidyselect 1.2.1 2024-03-11 [1] CRAN (R 4.4.0)
## tidyverse * 2.0.0 2023-02-22 [1] CRAN (R 4.4.0)
## timechange 0.4.0 2026-01-29 [1] CRAN (R 4.4.1)
## tzdb 0.5.0 2025-03-15 [1] CRAN (R 4.4.1)
## usethis * 3.2.1 2025-09-06 [1] CRAN (R 4.4.1)
## vctrs 0.7.1 2026-01-23 [1] CRAN (R 4.4.1)
## withr 3.0.2 2024-10-28 [1] CRAN (R 4.4.1)
## xfun 0.56 2026-01-18 [1] CRAN (R 4.4.1)
## xtable 1.8-4 2019-04-21 [1] CRAN (R 4.4.0)
## yaml 2.3.12 2025-12-10 [1] CRAN (R 4.4.1)
##
## [1] /Library/Frameworks/R.framework/Versions/4.4-x86_64/Resources/library
## * ── Packages attached to the search path.
##
## ──────────────────────────────────────────────────────────────────────────────